You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583593 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PLSCR1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PLSCR1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35kDa |
Target | PLSCR1 |
UniProt ID | O15162 |
Protein Sequence | Synthetic peptide located within the following region: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP |
NCBI | NP_066928 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MMTRA1B Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml. PLSCR1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. PLSCR1 is supported by BioGPS gene expression data to be expressed in 721_B.
Rabbit Anti-PLSCR1 Antibody, Catalog Number: orb583593, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-PLSCR1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.
ELISA, FC, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Canine, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |