PLPPR3 Peptide - middle region

SKU: orb2002430

Description

PLPPR3 Peptide - middle region, also known as LPR3, PRG2, LPPR3, PRG-2, is a synthetic peptide designed for use in combination with PLPPR3 Rabbit Polyclonal Antibody (orb580909). It corresponds to the sequence APGPKAAETASSSSASSDSSQYRSPSDRDSASIVTIDAHAPHHPVVHLSA and is supplied in a lyophilized powder. This peptide is for research use only.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Application Notes:
  This is a synthetic peptide designed for use in combination with PLPPR3 Rabbit Polyclonal Antibody (orb580909). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

• Protein Sequence: Synthetic peptide located within the following region: APGPKAAETASSSSASSDSSQYRSPSDRDSASIVTIDAHAPHHPVVHLSA

Storage & Handling

• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

LPR3, PRG2, LPPR3, PRG-2

Quick Database Links

UniProt

Q6T4P5