You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324496 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PLP1 |
Target | PLP1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PLP1 |
Protein Sequence | Synthetic peptide located within the following region: IYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ |
UniProt ID | P60201 |
MW | 30kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti MMPL antibody, anti PLP antibody, anti PLP/DM Read more... |
Note | For research use only |
NCBI | NP_000524 |
Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.
Positive control (+): Human Brain (BR), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 1 ug/mL.
Rabbit Anti-PLP1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cortex, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-PLP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Human, Monkey, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Canine, Equine, Human, Monkey, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
PE/Cy5.5 |