PLP1 Rabbit Polyclonal Antibody

• Catalog Number: orb324495
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PLP1
• Target: PLP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLP1
• Protein Sequence: Synthetic peptide located within the following region: GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL
• UniProt ID: P60201
• MW: 30kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti MMPL antibody, anti PLP antibody, anti PLP/DM
• Research Area: Cell Biology, Stem Cell & Developmental Biology
• Note: For research use only
• NCBI: NP_000524

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.

Brain, cerebellum.

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 0.5 ug/mL.

WB Suggested Anti-PLP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.