You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583140 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PIM1 |
Target | PIM1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PIM1 |
Protein Sequence | Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG |
UniProt ID | P11309 |
MW | 45kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | PIM |
Note | For research use only |
NCBI | NP_002639 |
Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.
WB Suggested Anti-PIM1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. PIM1 is supported by BioGPS gene expression data to be expressed in HEK293T.
WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Gallus, Guinea pig, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF | |
Bovine, Canine, Gallus, Guinea pig, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE/Cy5.5 |