You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329894 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Pias2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Rabbit |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse Pias2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 54kDa |
Target | Pias2 |
UniProt ID | Q8C5D8 |
Protein Sequence | Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE |
NCBI | AAB96678 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti 6330408K17Rik antibody, anti AI462206 antibod Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Mouse Pancreas
WB Suggested Anti-Pias2 Antibody Titration: 0.2-1 ug/mL, Positive Control: NIH/3T3 cell lysate.
WB Suggested Anti-Pias2 antibody Titration: 1 ug/mL, Sample Type: Human heart.
WB | |
Bovine, Canine, Equine, Mouse, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |