PHKG2 Rabbit Polyclonal Antibody

• Catalog Number: orb574500
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PHKG2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PHKG2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: PHKG2
• UniProt ID: P15735
• Protein Sequence: Synthetic peptide located within the following region: EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV
• NCBI: NP_000285
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GSD9C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Positive control (+): Mouse Testis (M-TE), Negative control (-): Mouse Small Intestine (M-IN), Antibody concentration: 1 ug/ml.

Human kidney

WB Suggested Anti-PHKG2 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate, PHKG2 is supported by BioGPS gene expression data to be expressed in HepG2.