PHGDH Rabbit Polyclonal Antibody

• Catalog Number: orb582487
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PHGDH
• Target: PHGDH
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHGDH
• Protein Sequence: Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF
• UniProt ID: O43175
• MW: 57 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: NLS, PDG, PGD, NLS1, PGAD, PGDH, SERA, 3PGDH, 3-PG
• Research Area: Neuroscience
• Note: For research use only
• NCBI: NP_006614

References

Maria Marchese 1, Sara Bernardi 2, Rachele Vivarelli 2, Stefano Doccini 2, Lorenzo Santucci 2, Asahi Ogi 2, Rosario Licitra 3, Jingjing Zang 4, Rabah Soliymani 5, Serena Mero 2, Stephan Cf Neuhauss 4, Lea Ciarmoli 6, Giovanni Signore 6 7, Maciej M Lalowski 5 8, Filippo M Santorelli 9 CLN5 deficiency impairs glucose uptake and uncovers PHGDH as a potential biomarker in Batten disease Mol Psychiatry ., (2025)

PubMed: 40346285

Applications

WB

Reactivity

Zebrafish

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Rabbit Anti-PHGDH antibody, Formalin Fixed Paraffin Embedded Tissue: Human Pancreas, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-PHGDH antibody, Formalin Fixed Paraffin Embedded Tissue: Human Prostate, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PHGDH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate. PHGDH is supported by BioGPS gene expression data to be expressed in HEK293T.