PHB2 Rabbit Polyclonal Antibody

• Catalog Number: orb580370
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PHB2
• Target: PHB2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PHB2
• Protein Sequence: Synthetic peptide located within the following region: KLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
• UniProt ID: Q99623
• MW: 33kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BAP, REA, p22, hBAP, Bap37, BCAP37, PNAS-141
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_009204

Rabbit Anti-PHB2 Antibody, Catalog Number: orb580370, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

Rabbit Anti-PHB2 Antibody, Catalog Number: orb580370, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PHB2 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. PHB2 is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-PHB2 antibody Titration: 1 ug/ml, Sample Type: Human heart.