You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579809 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PDIA4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PDIA4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 73kDa |
Target | PDIA4 |
UniProt ID | P13667 |
Protein Sequence | Synthetic peptide located within the following region: TAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYA |
NCBI | NP_004902 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ERP70, ERP72, ERp-72 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 293T, Antibody dilution: 1.0 ug/ml. PDIA4 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.
Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. PDIA4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
WB Suggested Anti-PDIA4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. PDIA4 is supported by BioGPS gene expression data to be expressed in HepG2.
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Mouse, Porcine, Rabbit, Zebrafish | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |