You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb579809 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PDIA4 |
| Target | PDIA4 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PDIA4 |
| Protein Sequence | Synthetic peptide located within the following region: TAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYA |
| UniProt ID | P13667 |
| MW | 73kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | ERP70, ERP72, ERp-72 |
| Research Area | Cell Biology, Signal Transduction |
| Note | For research use only |
| NCBI | NP_004902 |

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. PDIA4 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. PDIA4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

WB Suggested Anti-PDIA4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. PDIA4 is supported by BioGPS gene expression data to be expressed in HepG2.
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Mouse, Porcine, Rabbit, Zebrafish | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Human, Monkey, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy7 |
ICC, IF | |
Bovine, Human, Monkey, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy5.5 |
ICC, IF | |
Bovine, Human, Monkey, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
RBITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review