You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574391 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PCK1 |
Target | PCK1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PCK1 |
Protein Sequence | Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
UniProt ID | P35558 |
MW | 69kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | PCKDC, PEPCK1, PEPCKC, PEPCK-C |
Note | For research use only |
NCBI | NP_002582 |
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.
Human kidney
WB Suggested Anti-PCK1 Antibody Titration: 1.0 ug/ml, Positive Control: Fetal Brain Lysate.
Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Human 293T Whole Cell, Antibody dilution: 3 ug/ml.
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human, Porcine | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |