PCK1 Rabbit Polyclonal Antibody

• Catalog Number: orb574390
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PCK1
• Target: PCK1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Porcine
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCK1
• Protein Sequence: Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
• UniProt ID: P35558
• MW: 69 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PCKDC, PEPCK1, PEPCKC, PEPCK-C
• Note: For research use only
• NCBI: NP_002582

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-PCK1 Antibody, Positive Control: Lane 1: 80 ug pig serum, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:1000.

WB Suggested Anti-PCK1 Antibody, Positive Control: Lane 1: 80 ug pig serum protein, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:500.

WB Suggested Anti-PCK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.