PCBP1 Rabbit Polyclonal Antibody

SKU: orb330139

Description

PCBP1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PCBP1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of Human PCBP1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Infectious Disease & Virology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human PCBP1
• Target: PCBP1
• Protein Sequence: Synthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF
• Molecular Weight: 37 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti HNRPE1 antibody, anti HNRPX antibody, anti hnRNP-E1 antibody, anti hnRNP-X antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. A second isoform of 33 kDa also contains the peptide, and the protein is phosphorylated.

Anti-PCBP1 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human HCT116, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: MCF7 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL, PCBP1 is supported by BioGPS gene expression data to be expressed in MCF7.

Rabbit Anti-PCBP1 Antibody, Paraffin Embedded Tissue: Human Breast, Antibody Concentration: 5 ug/mL.

Rabbit Anti-PCBP1 Antibody, Paraffin Embedded Tissue: Human Breast, Antibody Concentration: 5 ug/mL.

Quick Database Links

Gene Symbol

PCBP1

UniProt

Q15365

RefSeq (Protein):NP_006187