PCBP1 Rabbit Polyclonal Antibody

• Catalog Number: orb330138
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PCBP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCBP1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39kDa
• Target: PCBP1
• UniProt ID: Q15365
• Protein Sequence: Synthetic peptide located within the following region: CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM
• NCBI: NP_006187
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HNRPX antibody, anti HNRPE1 antibody, anti hn
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. PCBP1 is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-PCBP1 Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate, PCBP1 is supported by BioGPS gene expression data to be expressed in HepG2.