PAX4 antibody

• Catalog Number: orb329645
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PAX4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PAX4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38 kDa
• Target: PAX4
• UniProt ID: O43316
• Protein Sequence: Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA
• NCBI: NP_006184
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti KPD antibody, anti MGC129960 antibody, anti M
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human COLO205 tissue using PAX4 antibody

Western blot analysis of Jurkat cell lysate tissue using PAX4 antibody

Western blot analysis of human Fetal Lung tissue using PAX4 antibody

Western blot analysis of human OVCAR3 tissue using PAX4 antibody