PAX4 Rabbit Polyclonal Antibody

• Catalog Number: orb329645
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PAX4
• Target: PAX4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PAX4
• Protein Sequence: Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA
• UniProt ID: O43316
• MW: 38 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti KPD antibody, anti MGC129960 antibody, anti M
• Research Area: Cancer Biology, Cell Biology, Epigenetics & Chroma
• Note: For research use only
• NCBI: NP_006184

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human NCI-H226, Antibody Dilution: 1.0 ug/mL.

Sample Type: COLO205, Antibody Dilution: 1.0 ug/mL, PAX4 is supported by BioGPS gene expression data to be expressed in COLO205.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Sample Type: OVCAR-3, Antibody Dilution: 1.0 ug/mL, PAX4 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-PAX4 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.