PAWR antibody

• Catalog Number: orb574359
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PAWR
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine
• Reactivity: Human, Mouse, Rabbit, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PAWR
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37kDa
• Target: PAWR
• UniProt ID: O75796
• Protein Sequence: Synthetic peptide located within the following region: SYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGT
• NCBI: NP_002574
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PAR4, Par-4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Jurkat using PAWR antibody.

Immunohistochemical staining of Human Kidney using PAWR antibody.

Immunohistochemical staining of Human Liver using PAWR antibody.