You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574359 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PAWR |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Canine, Equine |
Reactivity | Human, Mouse, Rabbit, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PAWR |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 37kDa |
Target | PAWR |
UniProt ID | O75796 |
Protein Sequence | Synthetic peptide located within the following region: SYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGT |
NCBI | NP_002574 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PAR4, Par-4 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Jurkat using PAWR antibody.
Immunohistochemical staining of Human Kidney using PAWR antibody.
Immunohistochemical staining of Human Liver using PAWR antibody.
ELISA, FC, ICC, IF, IHC, WB | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Other, Porcine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating