You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb574898 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PARP12 |
| Target | PARP12 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PARP12 |
| Protein Sequence | Synthetic peptide located within the following region: FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL |
| UniProt ID | Q9H0J9 |
| MW | 79kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | ZC3H1, ARTD12, MST109, MSTP109, ZC3HDC1 |
| Research Area | Epigenetics |
| Note | For research use only |
| NCBI | NP_073587 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. PARP12 is known to contain some ADP-ribosylated residues.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.

Rabbit Anti-PARP12 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-PARP12 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: ACHN cell lysate. PARP12 is supported by BioGPS gene expression data to be expressed in ACHN.
WB | |
Canine, Equine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
IHC, WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review