Cart summary

You have no items in your shopping cart.

PARP12 Rabbit Polyclonal Antibody (Biotin)

PARP12 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2135741

Select Product Size
SizePriceQuantity
100 μl$ 0.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb2135741
CategoryAntibodies
DescriptionPARP12 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PARP12
Protein SequenceSynthetic peptide located within the following region: FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL
UniProt IDQ9H0J9
MW79kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesZC3H1, ARTD12, MST109, MSTP109, ZC3HDC1
NoteFor research use only
NCBINP_073587
Images
Similar Products
Reviews

PARP12 Rabbit Polyclonal Antibody (Biotin) (orb2135741)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet