Cart summary

You have no items in your shopping cart.

PARP12 Rabbit Polyclonal Antibody (Biotin)

PARP12 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2135741

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2135741
CategoryAntibodies
DescriptionPARP12 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PARP12
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW79kDa
UniProt IDQ9H0J9
Protein SequenceSynthetic peptide located within the following region: FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL
NCBINP_073587
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesZC3H1, ARTD12, MST109, MSTP109, ZC3HDC1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.