You have no items in your shopping cart.
PARL Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PARL |
| Target | PARL |
| Protein Sequence | Synthetic peptide located within the following region: SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ |
| Molecular Weight | 36kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−PARL Antibody [orb1280023]
IHC
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
PARL Rabbit Polyclonal Antibody (HRP) [orb2118665]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Rabbit
Polyclonal
HRP
100 μlPARL Rabbit Polyclonal Antibody (FITC) [orb2118666]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Rabbit
Polyclonal
FITC
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/ml.

Human kidney

Rabbit Anti-PARL Antibody, Catalog Number: orb579312, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasmic in alveolar type I cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PARL Antibody Titration: 0.5 ug/ml, Positive Control: Jurkat cell lysate. PARL is supported by BioGPS gene expression data to be expressed in Jurkat.
Quick Database Links
UniProt Details
−NCBI Reference Sequences
−| Protein | NP_001032728 |
|---|
Documents Download
Request a Document
Protocol Information
PARL Rabbit Polyclonal Antibody (orb579312)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
