Cart summary

You have no items in your shopping cart.

PARL Rabbit Polyclonal Antibody (HRP)

PARL Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2118665

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2118665
CategoryAntibodies
DescriptionPARL Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PARL
Protein SequenceSynthetic peptide located within the following region: SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ
UniProt IDQ9H300
MW36kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesPSARL, PSARL1, RHBDS1, PRO2207, PSENIP2
NoteFor research use only
NCBINP_001032728
Expiration Date12 months from date of receipt.
  • PARL Rabbit Polyclonal Antibody (HRP) [orb480995]

    ELISA,  IHC-Fr,  IHC-P,  WB

    Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl