You have no items in your shopping cart.
Page Not Found
Cart summary
Item 1 of 1
PAGE4 Rabbit Polyclonal Antibody
Catalog Number: orb578434
| Catalog Number | orb578434 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PAGE4 |
| Target | PAGE4 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PAGE4 |
| Protein Sequence | Synthetic peptide located within the following region: PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ |
| UniProt ID | O60829 |
| MW | 11 |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | JM27, JM-27, CT16.7, GAGE-9, GAGEC1, PAGE-1, PAGE- Read more... |
| Note | For research use only |
| NCBI | NP_008934 |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-PAGE4 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
- Item 1 of 1
