You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578434 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PAGE4 |
Target | PAGE4 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PAGE4 |
Protein Sequence | Synthetic peptide located within the following region: PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ |
UniProt ID | O60829 |
MW | 11 |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | JM27, JM-27, CT16.7, GAGE-9, GAGEC1, PAGE-1, PAGE- Read more... |
Note | For research use only |
NCBI | NP_008934 |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-PAGE4 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.