Cart summary

You have no items in your shopping cart.

PAGE4 Rabbit Polyclonal Antibody (FITC)

PAGE4 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2122365

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2122365
CategoryAntibodies
DescriptionPAGE4 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PAGE4
Protein SequenceSynthetic peptide located within the following region: PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ
UniProt IDO60829
MW11
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesJM27, JM-27, CT16.7, GAGE-9, GAGEC1, PAGE-1, PAGE-
Read more...
NoteFor research use only
NCBINP_008934
Expiration Date12 months from date of receipt.