P2RY2 Rabbit Polyclonal Antibody

• Catalog Number: orb585579
• Category: Antibodies
• Description: Rabbit polyclonal antibody to P2RY2
• Target: P2RY2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: VRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSRRTE
• UniProt ID: P41231
• MW: 41kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: P2U, HP2U, P2U1, P2UR, P2Y2, P2RU1, P2Y2R
• Research Area: Neuroscience, Pharmacology & Drug Discovery
• Note: For research use only
• NCBI: NP_788085

WB Suggested Anti-P2RY2 Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell. P2RY2 is supported by BioGPS gene expression data to be expressed in MCF7.