You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585579 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to P2RY2 |
Target | P2RY2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: VRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSRRTE |
UniProt ID | P41231 |
MW | 41kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | P2U, HP2U, P2U1, P2UR, P2Y2, P2RU1, P2Y2R |
Note | For research use only |
NCBI | NP_788085 |
WB Suggested Anti-P2RY2 Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell. P2RY2 is supported by BioGPS gene expression data to be expressed in MCF7.
ELISA, IF, IHC-Fr, IHC-P, WB | |
Canine, Equine, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |