P2RY2 Rabbit Polyclonal Antibody

• Catalog Number: orb585578
• Category: Antibodies
• Description: Rabbit polyclonal antibody to P2RY2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Mouse, Porcine, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41kDa
• Target: P2RY2
• UniProt ID: P41231
• Protein Sequence: Synthetic peptide located within the following region: KPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSRRTESTPAGSE
• NCBI: NP_788085
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P2U, HP2U, P2U1, P2UR, P2Y2, P2RU1, P2Y2R
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml.

Positive control (+): THP-1 (N30), Negative control (-): A549 (N03), Antibody concentration: 5 ug/ml.

WB Suggested Anti-P2RY2 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell. P2RY2 is supported by BioGPS gene expression data to be expressed in 721_B.