p23 Protein

SKU: orb1714242

Description

Human Recombinant p23 Protein

Research Area

Cancer Biology, Cell Biology

Images & Validation

• Tested Applications: FA, SDS-PAGE, WB
• Application Notes:
  This product has been certified >90% pure using SDS PAGE analysis. 4uM orb1714242, when added to 2uM (Aha1)-activated HSP90 (2uM; His-tagged HSP90 beta) in 33mM Hepes pH7.2, 30mM NaCl, 5mM MgCl2, 1mM DTT, 1.5mM ATP in a 100ul reaction at 37 degrees C, eliminated all Aha1-mediated ATPase stimulation as well as intrinsic HSP90 ATPase activity. (This is an enzyme-linked ATP regeneration assay tracking loss of NADH absorbance at 340nm).

  Read more...

Key Properties

• Source: Recombinant
• Expression System: E. coli
• Biological Origin: Human
• Target: p23 Protein
• Reactivity: Human
• Tag: No tag
• Purification: Affinity Purified
• MW: ~23 kDa
• Purity: >90%
• Protein Sequence: SHMQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Storage & Handling

• Storage: -20°C
• Buffer/Preservatives: 20mM HEPES buffer pH 7.2, 80mM NaCl, 10% glycerol
• Concentration: Lot/batch specific. See included datasheet.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Sid 3177, Co chaperone p23, cPGES, HSP90 co chaperone, cytosolic prostaglandin E2 synthase, PTGES3, TEBP, Prostaglandin E synthase 3

Quick Database Links

Gene Symbol

p23 Protein

UniProt

Q15185