You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574203 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to OTX2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human OTX2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 32kDa |
Target | OTX2 |
UniProt ID | P32243 |
Protein Sequence | Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT |
NCBI | NP_068374 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CPHD6, MCOPS5 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: HepG2, Antibody dilution: 1.0 ug/ml.
Sample Type: Hela, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.
Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.
Human Heart
Human Stomach
WB Suggested Anti-OTX2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
ELISA, FC, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, WB | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Mouse, Other, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |