Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

OSTN Antibody Blocking Peptide

SKU: orb1500430

Description

This product is OSTN Antibody Blocking Peptide. Its molecular weight is 5.621 kDa. Its protein sequence is SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG-NH2. It targets Osteocrin. Purification is performed using HPLC.

Research Area

Stem Cell & Developmental Biology

Images & Validation

Key Properties

TargetOsteocrin
PurificationHPLC
MW5.621 kDa
Protein SequenceSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG-NH2

Storage & Handling

StorageShipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.
Form/AppearanceLyophilized
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Musclin; OSTN; OSTN_HUMAN.
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

100 μg
$ 190.00
500 μg
$ 450.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry