You have no items in your shopping cart.
Description
Research Area
Images & Validation
−Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Macaca mulatta (Rhesus macaque) |
| Tag | N-terminal 10xHis-tagged |
| Expression Region | 22-252aa |
| Protein Length | Partial |
| MW | 29.9 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−TRPV5 Rabbit Polyclonal Antibody [orb570361]
ELISA, FC, ICC, IHC, IHC-Fr, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgMouse Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2) ELISA Kit [orb780366]
Mouse
0.16-10 ng/mL
0.05 ng/mL
96 T, 48 THuman ONCM protein (Active) [orb359147]
> 97% as determined by SDS-PAGE and HPLC.
22.0 kDa
E.Coli
10 μg, 100 μg, 500 μgHuman ONCM protein (Active) [orb359148]
> 97% as determined by SDS-PAGE and HPLC.
23.7 kDa
E.Coli
10 μg, 100 μg, 500 μgHuman ONCM protein (Active) [orb359149]
> 95% as determined by SDS-PAGE and HPLC.
25.8 kDa
E.Coli
10 μg, 100 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
OSM Protein (orb1477195)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








