OMP Rabbit Polyclonal Antibody

• Catalog Number: orb583255
• Category: Antibodies
• Description: Rabbit polyclonal antibody to OMP
• Target: OMP
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Goat, Mouse
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OMP
• Protein Sequence: Synthetic peptide located within the following region: WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA
• UniProt ID: P47874
• MW: 19kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_006180

Sample Tissue: Human U937 Whole Cell, Antibody dilution: 5 ug/ml.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. OMP is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

WB Suggested Anti-OMP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.