You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb583255 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to OMP |
| Target | OMP |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Rat |
| Predicted Reactivity | Goat, Mouse |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human OMP |
| Protein Sequence | Synthetic peptide located within the following region: WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA |
| UniProt ID | P47874 |
| MW | 19kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Research Area | Epigenetics |
| Note | For research use only |
| NCBI | NP_006180 |

Sample Tissue: Human U937 Whole Cell, Antibody dilution: 5 ug/ml.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. OMP is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

WB Suggested Anti-OMP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
IF, IHC-Fr, IHC-P | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE |
IHC-Fr, IHC-P | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
HRP |
IF | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
FITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review