Omp Rabbit Polyclonal Antibody

• Catalog Number: orb583256
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Omp
• Target: Omp
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Human, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: EDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVV
• UniProt ID: Q64288
• MW: 18kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_035140

Sample Tissue: Mouse Thymus, Antibody dilution: 1 ug/ml.

WB Suggested Anti-Omp Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.