NXF1 Rabbit Polyclonal Antibody

• Catalog Number: orb577708
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NXF1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NXF1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 68kDa
• Target: NXF1
• UniProt ID: Q9UBU9
• Protein Sequence: Synthetic peptide located within the following region: MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSS
• NCBI: NP_006353
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TAP, MEX67
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: Lane 1: 7 ug HeLa lysate+EGFP SiRNA, Lane 2: 7 ug HeLa lysate+NXF1 SiRNA, Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:500, Gene Name: NXF1, NXF1 is supported by BioGPS gene expression data to be expressed in HeLa.

Rabbit Anti-NXF1Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-NXF1 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate. NXF1 is supported by BioGPS gene expression data to be expressed in HepG2.