You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582942 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LRRC33 |
Target | NRROS |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC33 |
Protein Sequence | Synthetic peptide located within the following region: GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL |
UniProt ID | Q86YC3 |
MW | 76kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | GARPL1, LRRC33, SENEBAC, UNQ3030, ELLP3030 |
Note | For research use only |
NCBI | NP_940967 |
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml.
Positive control (+): Human Stomach Tumor (T-ST), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 3 ug/ml.
WB Suggested Anti-LRRC33 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: PANC1 cell lysate.
IF, IHC-Fr, IHC-P, WB | |
Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-Fr, IHC-P, WB | |
Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |