NRG1 Rabbit Polyclonal Antibody

• Catalog Number: orb579923
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NRG1
• Target: NRG1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NRG1
• Protein Sequence: Synthetic peptide located within the following region: YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS
• UniProt ID: Q7RTW3
• MW: 70kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GGF, HGL, HRG, NDF, ARIA, GGF2, HRG1, HRGA, SMDF,
• Research Area: Cell Biology, Neuroscience, Signal Transduction
• Note: For research use only
• NCBI: NP_039251

NRG1 (neuregulin 1) Antibody (against the N terminal of NRG1) (50 ug) validated by WB using Fetal Brain Lysate at 0.2-1 ug/ml.