You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579923 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NRG1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NRG1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 70kDa |
Target | NRG1 |
UniProt ID | Q7RTW3 |
Protein Sequence | Synthetic peptide located within the following region: YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS |
NCBI | NP_039251 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GGF, HGL, HRG, NDF, ARIA, GGF2, HRG1, HRGA, SMDF, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
NRG1 (neuregulin 1) Antibody (against the N terminal of NRG1) (50 ug) validated by WB using Fetal Brain Lysate at 0.2-1 ug/ml.
IF, IHC-Fr, IHC-P | |
Bovine, Equine, Human, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC-Fr, IHC-P, WB | |
Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Canine, Gallus, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Mouse, Rat | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |