NR5A2 Rabbit Polyclonal Antibody

• Catalog Number: orb576653
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR5A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Guinea pig, Porcine, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NR5A2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61kDa
• Target: NR5A2
• UniProt ID: O00482
• Protein Sequence: Synthetic peptide located within the following region: MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGY
• NCBI: NP_995582
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: B1F, CPF, FTF, B1F2, LRH1, LRH-1, FTZ-F1, hB1F-2,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-NR5A2 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.