NR5A2 Rabbit Polyclonal Antibody

• Catalog Number: orb576301
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR5A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Guinea pig, Human, Rabbit, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human Nr5a2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64kDa
• Target: Nr5a2
• UniProt ID: P45448
• Protein Sequence: Synthetic peptide located within the following region: PDRHRRPIPARSRLVMLPKVETEAPGLVRSHGEQGQMPENMQVSQFKMVN
• NCBI: NP_109601
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Ftf, LRH, LRH-1, UF2-H3B, AU020803, D1Ertd308, D1E
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Nr5a2 Antibody Titration: 0.2-1 ug/ml, Positive Control: SP2/0 cell lysate.