NR1H3 Rabbit Polyclonal Antibody

• Catalog Number: orb576783
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR1H3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NR1H3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50 kDa
• Target: NR1H3
• UniProt ID: Q13133
• Protein Sequence: Synthetic peptide located within the following region: IHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWD
• NCBI: NP_005684
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LXRA, LXR-a, RLD-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is also present in a 28 kDa isoform.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-NR1H3 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.