NPM2 Rabbit Polyclonal Antibody

• Catalog Number: orb583952
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NPM2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Equine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NPM2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purity: Affinity Purified
• Conjugation: Unconjugated
• MW: 24kDa
• Target: NPM2
• UniProt ID: Q86SE8
• Protein Sequence: Synthetic peptide located within the following region: LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA
• NCBI: NP_877724
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles
• Buffer/Preservatives: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
• Alternative names: MGC78655
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-NPM2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.