NPM2 Rabbit Polyclonal Antibody

• Catalog Number: orb583951
• Category: Antibodies
• Description: NPM2 is a core histones chaperone involved in chromatin reprogramming, specially during fertilization and early embryonic development. It probably involved in sperm DNA decondensation during fertilization
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NPM2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purity: Affinity Purified
• Conjugation: Unconjugated
• MW: 23kDa
• Target: NPM2
• UniProt ID: Q86SE8
• Protein Sequence: Synthetic peptide located within the following region: MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTIC
• NCBI: XP_005273429
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles
• Buffer/Preservatives: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NPM2,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Thymus Tumor lysates, Antibody dilution: 1.0 ug/ml.