NPM1 Rabbit Polyclonal Antibody

• Catalog Number: orb574931
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NPM1
• Target: NPM1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NPM1
• Protein Sequence: Synthetic peptide located within the following region: DMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKD
• UniProt ID: P06748
• MW: 33kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: B23, NPM
• Research Area: Cell Biology, Epigenetics & Chromatin, Molecular B
• Note: For research use only
• NCBI: NP_002511
• Expiration Date: 12 months from date of receipt.

Sample Type: human cornea (frozen), Blue: DAPI, Red: NPM1, Primary dilution: 1:100.

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. There is BioGPS gene expression data showing that NPM1 is expressed in HepG2.

Human Lung

WB Suggested Anti-NPM1 Antibody Titration: 1.0 ug/ml, Positive Control: HepG2 cell lysate, There is BioGPS gene expression data showing that NPM1 is expressed in HepG2.