You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329987 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NOTCH4 |
Target | NOTCH4 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NOTCH4 |
Protein Sequence | Synthetic peptide located within the following region: CDWVALGACGSASNIPIPPPCLTPSPERGSPQLDCGPPALQEMPINQGGE |
UniProt ID | Q99466 |
MW | 58kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti INT3 antibody, anti NOTCH4 antibody |
Research Area | Cardiovascular Research, Cell Biology, Epigenetics Read more... |
Note | For research use only |
NCBI | NP_004548 |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-NOTCH4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Equine, Guinea pig, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Human, Monkey, Mouse | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |