NOTCH4 Rabbit Polyclonal Antibody

• Catalog Number: orb329684
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NOTCH4
• Target: NOTCH4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NOTCH4
• Protein Sequence: Synthetic peptide located within the following region: LLLGLGAARELRDQAGLAPADVAHQRNHWDLLTLLEGAGPPEARHKATPG
• UniProt ID: Q99466
• MW: 61kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti INT3 antibody, anti NOTCH4 antibody
• Research Area: Cardiovascular Research, Cell Biology, Epigenetics
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Lung Tumor, Antibody Dilution: 1.0 ug/mL.

Immunohistochemistry with Human Breast tissue at an antibody concentration of 5.0 ug/mL using anti-NOTCH4 antibody (orb329684).

WB Suggested Anti-NOTCH4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.