NOS2 Rabbit Polyclonal Antibody

• Catalog Number: orb585494
• Category: Antibodies
• Description: Rabbit polyclonal antibody to iNOS
• Target: NOS2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: PCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSS
• UniProt ID: P35228
• MW: 110kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: NOS, INOS, NOS2A, HEP-NOS
• Research Area: Cancer Biology, Neuroscience
• Note: For research use only
• NCBI: EAW51048

Lanes: Lane 1: 30 ug human placental tissue lysate, Lane 2: 30 ug human placental tissue lysate, Lane 3: 30 ug human placental tissue lysate, Lane 4: 30 ug human placental tissue lysate, Lane 5: 20 ug human myometrial tissue lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: Nitric oxide synthase 2, inducible (NOS2).

Rabbit Anti-NOS2 Antibody, Catalog Number: orb585494, Formalin Fixed Paraffin Embedded Tissue: Human Appendix (Colon) Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Application: Western blotting, Species+tissue/cell type: Human placental and myometrial tissue lysate, How many ug'sof tissue/cell lysate run on the gel: 1: 50 ug human placental tissue lysate, 2: 40 ug human placental tissue lysate, 3: 30 ug human placental tissue lysate, 4: 20 ug human placental tissue lysate, 5: 10 ug human placental tissue lysate, 6: 20 ug human myometrial tissue lysate, Primary antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit HRP, Secondary antibody dilution: 1:10000.

Sample Type: Human placental tissue, Primary Antibody dilution: 1:50, Secondary Antibody: Goat anti rabbit-HRP, Secondary Antibody dilution: 1:10000, Color/Signal Descriptions: Brown: NOS2 Purple: Haemotoxylin, Gene Name: NOS2.

WB Suggested Anti-NOS2 Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.