You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586154 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NMUR1 |
Target | NMUR1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: CHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQQETDPS |
UniProt ID | Q9HB89 |
MW | 44kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | FM3, FM-3, GPC-R, GPR66, NMU1R, (FM-3) |
Note | For research use only |
NCBI | AAC02680 |
Antibody dilution: 1.0 ug/ml, Sample Type: A549 cell lysate. NMUR1 is supported by BioGPS gene expression data to be expressed in A549.
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Mouse, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |