You have no items in your shopping cart.
Cart summary
Item 1 of 1
NMUR1 Rabbit Polyclonal Antibody
Catalog Number: orb586155
| Catalog Number | orb586155 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to NMUR1 |
| Target | NMUR1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Mouse, Rabbit |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Sequence | Synthetic peptide located within the following region: GLRLRRERLLLMQEAKGRGSAAARSRYTCRLQQHDRGRRQVTKMLFVLVV |
| UniProt ID | Q9HB89 |
| MW | 44kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | FM3, FM-3, GPC-R, GPR66, NMU1R, (FM-3) |
| Note | For research use only |
| NCBI | AAC02680 |
Antibody dilution: 1.0 ug/ml, Sample Type: ACHN cell lysate.
- Item 1 of 2
Anti-GPR66 Antibody [orb515262]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 30 μl - Item 1 of 2
NMUR1/GPR66 Rabbit Polyclonal Antibody [orb526582]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl - Item 1 of 2
- Item 1 of 2
- Item 1 of 1
