NLRP1 Rabbit Polyclonal Antibody

• Catalog Number: orb325922
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NLRP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NLRP1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 165 kDa
• Target: NLRP1
• UniProt ID: Q9C000
• Protein Sequence: Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL
• NCBI: NP_001028225
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CARD7 antibody, anti CLR17.1 antibody, anti D
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18 % SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-NLRP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: NCI-H226 cell lysate, NLRP1 is strongly supported by BioGPS gene expression data to be expressed in NCI-H226.