You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325922 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NLRP1 |
Target | NLRP1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NLRP1 |
Protein Sequence | Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL |
UniProt ID | Q9C000 |
MW | 165 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti CARD7 antibody, anti CLR17.1 antibody, anti D Read more... |
Note | For research use only |
NCBI | NP_001028225 |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18 % SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL.
Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-NLRP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: NCI-H226 cell lysate, NLRP1 is strongly supported by BioGPS gene expression data to be expressed in NCI-H226.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
APC |
ELISA, IF, IHC-Fr, IHC-P | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |