NFATC3 Rabbit Polyclonal Antibody

• Catalog Number: orb592964
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NFATC3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 115kDa
• Target: NFATC3
• UniProt ID: B5B2S0
• Protein Sequence: Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI
• NCBI: NP_004546
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NFAT4, NFATX, NF-AT4c
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.

Immunohistochemistry with Thymus tissue at an antibody concentration of 5 ug/ml using anti-NFATC3 antibody (orb592964).

Rabbit Anti-NFATC3 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-NFATC3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.