You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576851 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NFAT5 |
Target | NFAT5 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NFAT5 |
Protein Sequence | Synthetic peptide located within the following region: PGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGN |
UniProt ID | O94916 |
MW | 166kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | NFATZ, OREBP, NF-AT5, NFATL1, TONEBP |
Note | For research use only |
NCBI | NP_006590 |
WB Suggested Anti-NFAT5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate.
ELISA, WB | |
Human, Mouse | |
Polyclonal | |
Unconjugated |
ELISA, IF | |
Human, Mouse | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |