Neuropeptide Y (3-36), human

SKU: orb2694244

Description

Neuropeptide Y (3-36) (human, rat), a neuropeptide Y (NPY) metabolite formed from dipeptidyl peptidase-4 (DPP4), is a selective Y2 receptor agonist. Neuropeptide Y (3-36) (human, rat) is a NPY metabolite formed from dipeptidyl peptidase-4 (DPP4). Neuropeptide Y (3-36) (human, rat) decreases release of norepinephrine via the Y2 receptor.

Images & Validation

−

Key Properties

−

Target	Neurokinin Receptor
CAS Number	150138-78-6
MW	4011.48
Purity	≥95%
Formula	C₁₇₅H₂₆₉N₅₃O₅₄S
Protein Sequence	SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Neurokinin Receptor

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols