NECAB1 Rabbit Polyclonal Antibody

• Catalog Number: orb326222
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NECA1
• Target: NECAB1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NECA1
• Protein Sequence: Synthetic peptide located within the following region: DSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFK
• UniProt ID: Q8N987
• MW: 38kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti NECAB1 antibody, anti EFCBP1 antibody, anti a
• Note: For research use only
• NCBI: NP_071746

Sample Type: Thymus Tumor lysates, Antibody Dilution: 1.0 ug/mL.