Cart summary

You have no items in your shopping cart.

NDUFAF3 Rabbit Polyclonal Antibody

Catalog Number: orb55742

Select Product Size
SizePriceQuantity
100 μl$ 600.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb55742
CategoryAntibodies
DescriptionRabbit polyclonal antibody to NDUFAF3.
TargetNDUFAF3
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
ReactivityHuman
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
PurificationAffinity purified
ImmunogenThe immunogen for Anti-NDUFAF3 antibody is: synthetic peptide directed towards the N-terminal of Human NDUF3
Protein SequenceSynthetic peptide located within the following region: LPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYIDSYNSRGFMINGN
UniProt IDQ9BU61
MW20 kDa
Tested applicationsWB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative names2P1, E3-3, C3orf60, MC1DN18
NoteFor research use only
NCBINP_951032.1
Images
NDUFAF3 Rabbit Polyclonal Antibody

Sample Type: Hela Whole Cell, Antibody dilution: 1.0 ug/ml.

Similar Products
Reviews

NDUFAF3 Rabbit Polyclonal Antibody (orb55742)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet